1. #6671
    Pro User

    Oct 2016
    5,954,609

    Newsensations.com- Brittany Young - Shane Diesel s Cuckold Stories 5

    Newsensations.com- Brittany Young - Shane Diesel_s Cuckold Stories 5





    Description:

    Blond juicy jugged Britney Young is in need of thicker and harder cock inside her pussy. Shane takes on the challenge of stuffing her tight pink pussy by filling her mouth first. Britney could barely fit every inch of Shane_s meat and wanted him balls deep. Shane fucked her wide and sprayed her with his snake juice.
    Model:
    Britney Young, Shane Diesel
    Studio:
    Newsensations.com
    Info:
    File Name : britney_young_shane_diesel_shanedieselscuckoldstor ies05.mp4
    File Size : 343.68 MB
    Resolution : 1280x720
    Duration : 00:29:21
    Video : AVC (AVC), 1 500 Kbps, 29.000 fps
    Audio : AAC (AAC LC), 128 Kbps (CBR), 48.0 KHz, 2 channels, 1 stream

    Download Screenshots:
    UbiqFile Zip:sdbb-britney_young_shane_diesel_ShaneDieselsCuckoldStor ies05_1920.zip - 8.7 MB

    Download VIDEO:
    UbiqFile:britney_young_shane_diesel_shanedieselscu ckoldstories05.mp4 - 343.7 MB

  2. #6672
    Pro User

    Oct 2016
    5,954,609

    Newsensations.com- Britney Young - Pretty.Dirty 2

    Newsensations.com- Britney Young - Pretty.Dirty 2





    Description:

    Britney Young is one pretty...dirty girl Don_t let the innocent look fool you. Once Britney gets down and dirty all she can think of is a big hard cock to suck and fuck. Cum bust a load for this little tight spinner and see why shes one pretty dirty girl
    Model:
    Britney Young, Tyler Nixon
    Studio:
    Newsensations.com
    Info:
    File Name : britney_young_tyler_nixon_prettydirty.mp4
    File Size : 312.37 MB
    Resolution : 1280x720
    Duration : 00:26:40
    Video : AVC (AVC), 1 500 Kbps, 29.000 fps
    Audio : AAC (AAC LC), 128 Kbps (VBR), 48.0 KHz, 2 channels, 1 stream

    Download Screenshots:
    UbiqFile Zip:ns-britney_young_tyler_nixon_PrettyDirty02_1920.zip - 7.0 MB

    Download VIDEO:
    UbiqFile:britney_young_tyler_nixon_prettydirty.mp4 - 312.4 MB

  3. #6673
    Pro User

    Oct 2016
    5,954,609

    Newsensations.com- Gisselle - MILF Date 4

    Newsensations.com- Gisselle - MILF Date 4





    Description:

    Gisselle has cum for a mouth and pussy stretching of a lifetime. Shane unleashes the zipper beast for Gisselle to mop on and spreads her pussy wide for entrance, as he gently shoves in his massive inches. Poor Gisselle took the cock plowing deep up to his balls in her pink and stood tall to take all the hot ball gravy Shane had to spray her mouth with.
    Model:
    Gisselle, Shane Diesel
    Studio:
    Newsensations.com
    Info:
    File Name : gisselle_shane_diesel_milfdate04.mp4
    File Size : 273.4 MB
    Resolution : 1280x720
    Duration : 00:23:24
    Video : AVC (AVC), 1 500 Kbps, 29.000 fps
    Audio : AAC (AAC LC), 128 Kbps (VBR), 48.0 KHz, 2 channels, 1 stream

    Download Screenshots:
    UbiqFile Zip:sdbb-gisselle_MilfDate04_16x9.zip - 27.2 MB

    Download VIDEO:
    UbiqFile:gisselle_shane_diesel_milfdate04.mp4 - 273.4 MB

  4. #6674
    Pro User

    Oct 2016
    5,954,609

    Newsensations.com- Allyssa Hall - Screw My Girlfriend While I Watch

    Newsensations.com- Allyssa Hall - Screw My Girlfriend While I Watch





    Description:

    Allyssa Hall has decided to fulfill her boyfriends fantasy and let another man fuck her stupid while he watches. The surly chap arrives promptly and proceeds to cram his enormous cock deep within every available orifice. The boyfriend watches with wide eyes as the surrogate blows a mammoth load into her grinning grill.
    Model:
    Allyssa Hall, Tommy Gunn
    Studio:
    Newsensations.com
    Info:
    File Name : allyssa_hall_screwmygirlfriendwhileiwatch.mp4
    File Size : 1923.06 MB
    Resolution : 1280x720
    Duration : 00:43:52
    Video : AVC (AVC), 6 000 Kbps, 29.000 fps
    Audio : AAC (AAC LC), 128 Kbps (CBR), 48.0 KHz, 2 channels, 1 stream

    Download Screenshots:
    UbiqFile Zip:jb-allyssa_hall_SMGWIW_16x9.zip - 28.4 MB

    Download VIDEO:
    UbiqFile:allyssa_hall_screwmygirlfriendwhileiwatch .mp4 - 1.9 GB

  5. #6675
    Pro User

    Oct 2016
    5,954,609

    Newsensations.com- Eden Adams - Keepin It Fresh 03

    Newsensations.com- Eden Adams - Keepin_ It Fresh 03





    Description:

    Sweet young babe Eden Adams is crazy for cock and when her man is not meeting her needs she gives us a call. We come right over and get to the fucking With her mouth full of our meat, Eden works in and out of her throat for one hell of a blow job. Eden really likes to be fucked hard and our meat gives her everything she wants. There_s nothing like a girl who enjoys a good pussy slam and a face full of sticky goo
    Model:
    Eden Adams, Jordan Ash
    Studio:
    Newsensations.com
    Info:
    File Name : eden_adams_jordan_ash_keepin-itfresh-03.mp4
    File Size : 286.67 MB
    Resolution : 1280x720
    Duration : 00:24:27
    Video : AVC (AVC), 1 500 Kbps, 29.000 fps
    Audio : AAC (AAC LC), 128 Kbps (CBR), 48.0 KHz, 2 channels, 1 stream

    Download Screenshots:
    UbiqFile Zip:ns-eden_adams_jordan_ash_KeepinItFresh03_16x9.zip - 50.7 MB

    Download VIDEO:
    UbiqFile:eden_adams_jordan_ash_keepin-itfresh-03.mp4 - 286.7 MB

  6. #6676
    Pro User

    Oct 2016
    5,954,609

    Newsensations.com- Maya Hills - She Only Takes Diesel 03

    Newsensations.com- Maya Hills - She Only Takes Diesel 03





    Description:

    This tiny blonde is about to get her pussy wrecked. Maya Hills had heard the rumors and now is about to find out that they are true Maya wraps her lips around this giant black shaft, sucking and licking as her spit runs down her chin. Once we flip her over we have a clear shot at her tight twat. Cramming our cock deep inside, we drill her pink velvet tunnel leaving her tore up pussy gapping With her pussy sore and our cock chowder dripping from her chin, Maya goes home a happy girl
    Model:
    Maya Hills, Shane Diesel
    Studio:
    Newsensations.com
    Info:
    File Name : maya_hills_shane_diesel_sheonlytakesdiesel03.mp4
    File Size : 1254.53 MB
    Resolution : 1280x720
    Duration : 00:28:30
    Video : AVC (AVC), 6 000 Kbps, 29.000 fps
    Audio : AAC (AAC LC), 128 Kbps (CBR), 48.0 KHz, 2 channels, 1 stream

    Download Screenshots:
    UbiqFile Zip:sdbb-maya_hills_shane_diesel_SOTD03_clip0116x9.zip - 29.1 MB

    Download VIDEO:
    UbiqFile:maya_hills_shane_diesel_sheonlytakesdiese l03.mp4 - 1.2 GB

  7. #6677
    Pro User

    Oct 2016
    5,954,609

    Newsensations.com- Kylee Lovit - MILF Date 4

    Newsensations.com- Kylee Lovit - MILF Date 4





    Description:

    Mmmm...Kylee Lovit and her bodacious honey chest...nom nom. Kylee set the girls free and our zipper let the love muscle flex and tear into those tits. After hours of her sucking and tit fucking we moved into that dripping wet pussy of hers and dug in ball deep. Our cock was in melon heaven and pink blessings until her juggs were calling, for a gallon load of tit protein man cream.
    Model:
    Domenic Kane, Kylee Lovit
    Studio:
    Newsensations.com
    Info:
    File Name : kylee_lovit_domenic_kane_milfdate04.mp4
    File Size : 327.34 MB
    Resolution : 1280x720
    Duration : 00:27:53
    Video : AVC (AVC), 1 500 Kbps, 29.000 fps
    Audio : AAC (AAC LC), 128 Kbps (VBR), 48.0 KHz, 2 channels, 1 stream

    Download Screenshots:
    UbiqFile Zip:um-kylee_lovit_MilfDate04_16x9.zip - 24.1 MB

    Download VIDEO:
    UbiqFile:kylee_lovit_domenic_kane_milfdate04.mp4 - 327.3 MB

  8. #6678
    Pro User

    Oct 2016
    5,954,609

    Newsensations.com- Kylie G Worthy - MILFs Take Diesel 01

    Newsensations.com- Kylie G Worthy - MILFs Take Diesel 01





    Description:

    Kylie Worthy and her massive ta-tas love nothing more than to have Shane Diesel_s huge cock in her mouth or stretching her pussy wide. This MILF knows how to work her muscles around this dick to get everything out of such a gigantic tool. Cum see Kylie Worthy as she gets a poundin_ and gets a special delivery of hot goodness to the face
    Model:
    Kylie G Worthy, Shane Diesel
    Studio:
    Newsensations.com
    Info:
    File Name : kylie_worthy_shane_diesel_milfstakediesel01.mp4
    File Size : 1006.18 MB
    Resolution : 1280x720
    Duration : 00:22:57
    Video : AVC (AVC), 6 000 Kbps, 29.000 fps
    Audio : AAC (AAC LC), 128 Kbps (CBR), 48.0 KHz, 2 channels, 1 stream

    Download Screenshots:
    UbiqFile Zip:sdbb-kylie_worthy_shane_diesel_MILFSTakeDiesel_16x9.zip - 35.6 MB

    Download VIDEO:
    UbiqFile:kylie_worthy_shane_diesel_milfstakediesel 01.mp4 - 1006.2 MB

  9. #6679
    Pro User

    Oct 2016
    5,954,609

    Newsensations.com- Audrey Bitoni - Ashlynn Friends 02

    Newsensations.com- Audrey Bitoni - Ashlynn Friends 02





    Description:

    Watch this sweet piece of ass sucking and fucking a fat hard cock. Audrey Bitoni loves nothing more then having her pussy stretched wide and pounded by a big hard cock...but a close second is having warm spunk shot on her face
    Model:
    Audrey Bitoni, Mark Ashley
    Studio:
    Newsensations.com
    Info:
    File Name : audrey_ashlynnandfriends-02.mp4
    File Size : 278.92 MB
    Resolution : 1280x720
    Duration : 00:23:49
    Video : AVC (AVC), 1 500 Kbps, 29.000 fps
    Audio : AAC (AAC LC), 129 Kbps (CBR), 48.0 KHz, 2 channels, 1 stream

    Download Screenshots:
    UbiqFile Zip:ns-audrey_bitoni_mark_ashley_AF2_16x9.zip - 8.6 MB

    Download VIDEO:
    UbiqFile:audrey_ashlynnandfriends-02.mp4 - 278.9 MB

  10. #6680
    Pro User

    Oct 2016
    5,954,609

    Newsensations.com- Brianna Love - What An Ass 05

    Newsensations.com- Brianna Love - What An Ass 05





    Description:

    Brianna Love has more then an addiction to cock, she is a cock junkie We wag our bone in her face and she gets the hint and starts sucking down our meat. Brianna takes control grabs our pole and crams it deep in her pussy. This babe can ride a damn cock like no other, grinding and squeezing her twat on our cock milking our meat until we blow all over her fine round ass
    Model:
    Brianna Love, James Deen
    Studio:
    Newsensations.com
    Info:
    File Name : brianna_love_james_deen_what-an-ass-05.mp4
    File Size : 444.85 MB
    Resolution : 1280x720
    Duration : 00:38:15
    Video : AVC (AVC), 1 500 Kbps, 29.000 fps
    Audio : AAC (AAC LC), 128 Kbps (CBR), 48.0 KHz, 2 channels, 1 stream

    Download Screenshots:
    UbiqFile Zip:ns-brianna_love_james_deen_WhatAnAss05_16x9.zip - 22.3 MB

    Download VIDEO:
    UbiqFile:brianna_love_james_deen_what-an-ass-05.mp4 - 444.8 MB

Thread Information

Users Browsing this Thread

There are currently 1 users browsing this thread. (0 members and 1 guests)

Tags for this Thread

  •